LSM14A anticorps

N° du produit ABIN632116

Cet anticorps Lapin Polyclonal détecte spécifiquement LSM14A dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LSM14A anticorps (ABIN632116)

Antigène: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSM14A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LSM14A anticorps

Purification: Affinity purified

Immunogène: LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSM14A Blocking Peptide, (ABIN5614597), is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSM14A

Antigène: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Autre désignation: LSM14A

Sujet: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization