LSM14A anticorps
-
- Antigène Voir toutes LSM14A Anticorps
- LSM14A (LSM14A, SCD6 Homolog A (LSM14A))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LSM14A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP
- Top Product
- Discover our top product LSM14A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LSM14A Blocking Peptide, catalog no. 33R-9285, is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LSM14A (LSM14A, SCD6 Homolog A (LSM14A))
- Autre désignation
- LSM14A (LSM14A Produits)
- Synonymes
- anticorps C19orf13, anticorps FAM61A, anticorps RAP55, anticorps RAP55A, anticorps 2700023B17Rik, anticorps AA407828, anticorps AU017544, anticorps Tral, anticorps RGD1305695, anticorps fam61a, anticorps lsm14a, anticorps wu:fj52e11, anticorps zgc:63681, anticorps zgc:66203, anticorps zgc:77302, anticorps rap55, anticorps RAP55A-A, anticorps rap55a, anticorps xRAP55, anticorps xRAP55A, anticorps RAP55A-B, anticorps wu:fc55d12, anticorps zgc:55754, anticorps zgc:77202, anticorps LSM14A, mRNA processing body assembly factor, anticorps LSM14A mRNA processing body assembly factor, anticorps LSM14A mRNA processing body assembly factor a, anticorps LSM14A mRNA processing body assembly factor L homeolog, anticorps LSM14A mRNA processing body assembly factor S homeolog, anticorps LSM14A mRNA processing body assembly factor b, anticorps LSM14A, anticorps Lsm14a, anticorps lsm14aa, anticorps lsm14a, anticorps lsm14a.L, anticorps lsm14a.S, anticorps lsm14ab
- Sujet
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization
-