IMPA1 anticorps (Middle Region)

N° du produit ABIN632122

Détail du produit anti-IMPA1 anticorps

Antigène: IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IMPA1 antibody was raised against the middle region of IMPA1

Purification: Affinity purified

Immunogène: IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPA1 Blocking Peptide, catalog no. 33R-4209, is also available for use as a blocking control in assays to test for specificity of this IMPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPA1

Antigène: IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))

Autre désignation: IMPA1 (IMPA1 Produits)

Synonymes: anticorps zgc:100926, anticorps 2610002K09Rik, anticorps 2900059K10Rik, anticorps AI325909, anticorps IMP, anticorps IMPA, anticorps impa, anticorps inositol monophosphatase 1, anticorps inositol(myo)-1(or 4)-monophosphatase 1, anticorps inositol (myo)-1(or 4)-monophosphatase 1, anticorps inositol monophosphatase, anticorps inositol(myo)-1(or 4)-monophosphatase 1 S homeolog, anticorps impa1, anticorps Impa1, anticorps IMPA1, anticorps impa1.S

Sujet: IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

Poids moléculaire: 30 kDa (MW of target protein)