EML1 anticorps (C-Term)

N° du produit ABIN632123

Détail du produit anti-EML1 anticorps

Antigène: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EML1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EML1 antibody was raised against the C terminal of EML1

Purification: Affinity purified

Immunogène: EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EML1 Blocking Peptide, catalog no. 33R-10195, is also available for use as a blocking control in assays to test for specificity of this EML1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EML1

Antigène: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Autre désignation: EML1 (EML1 Produits)

Synonymes: anticorps ELP79, anticorps EMAP, anticorps EMAPL, anticorps HuEMAP, anticorps EML1, anticorps MGC108311, anticorps wu:fj01a06, anticorps zgc:153105, anticorps 1110008N23Rik, anticorps A930030P13Rik, anticorps AA171013, anticorps AI847476, anticorps AI853955, anticorps echinoderm microtubule associated protein like 1, anticorps echinoderm microtubule associated protein like 1 S homeolog, anticorps EML1, anticorps eml1.S, anticorps eml1, anticorps Eml1

Sujet: Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type.

Poids moléculaire: 92 kDa (MW of target protein)