EML1 anticorps (C-Term)

N° du produit ABIN632123

L’anticorps anti-EML1 Polyclonal Lapin est utilisé pour la détection de EML1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour EML1 anticorps (C-Term) (ABIN632123)

Antigène: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EML1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EML1 anticorps

Épitope: C-Term

Specificité: EML1 antibody was raised against the C terminal of EML1

Purification: Affinity purified

Immunogène: EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EML1 Blocking Peptide, (ABIN936166), is also available for use as a blocking control in assays to test for specificity of this EML1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EML1

Antigène: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Autre désignation: EML1

Sujet: Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type.

Poids moléculaire: 92 kDa (MW of target protein)