RTDR1 anticorps (Middle Region)

N° du produit ABIN632124

Détail du produit anti-RTDR1 anticorps

Antigène: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RTDR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RTDR1 antibody was raised against the middle region of RTDR1

Purification: Affinity purified

Immunogène: RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RTDR1 Blocking Peptide, catalog no. 33R-3896, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RTDR1

Antigène: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Autre désignation: RTDR1 (RTDR1 Produits)

Synonymes: anticorps 4933431K05Rik, anticorps si:dkey-220o5.4, anticorps radial spoke head 14 homolog, anticorps rtdr1, putative, anticorps radial spoke head homolog 14 (Chlamydomonas), anticorps radial spoke head 14 homolog (Chlamydomonas), anticorps RSPH14, anticorps Smp_151730, anticorps Rsph14, anticorps rsph14

Sujet: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Poids moléculaire: 38 kDa (MW of target protein)