ETF1 anticorps (N-Term)

N° du produit ABIN632229

Détail du produit anti-ETF1 anticorps

Antigène: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ETF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ETF1 antibody was raised against the N terminal of ETF1

Purification: Affinity purified

Immunogène: ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ETF1

Antigène: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Autre désignation: ETF1 (ETF1 Produits)

Sujet: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.

Poids moléculaire: 49 kDa (MW of target protein)