ETF1 anticorps (N-Term)
-
- Antigène Voir toutes ETF1 Anticorps
- ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ETF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ETF1 antibody was raised against the N terminal of ETF1
- Purification
- Affinity purified
- Immunogène
- ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL
- Top Product
- Discover our top product ETF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))
- Autre désignation
- ETF1 (ETF1 Produits)
- Sujet
- Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.
- Poids moléculaire
- 49 kDa (MW of target protein)
-