IFI44 anticorps (Middle Region)

N° du produit ABIN632234

Détail du produit anti-IFI44 anticorps

Antigène: IFI44 (Interferon-Induced Protein 44 (IFI44))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFI44 est non-conjugé

Application: Western Blotting (WB)

Specificité: IFI44 antibody was raised against the middle region of IFI44

Purification: Affinity purified

Immunogène: IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFI44 Blocking Peptide, catalog no. 33R-5042, is also available for use as a blocking control in assays to test for specificity of this IFI44 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFI44

Antigène: IFI44 (Interferon-Induced Protein 44 (IFI44))

Autre désignation: IFI44 (IFI44 Produits)

Synonymes: anticorps MATP44, anticorps MTAP44, anticorps TLDC5, anticorps p44, anticorps A430056A10Rik, anticorps AW261460, anticorps interferon induced protein 44, anticorps interferon-induced protein 44, anticorps IFI44, anticorps Ifi44

Sujet: This protein aggregates to form microtubular structures.

Poids moléculaire: 50 kDa (MW of target protein)