ITPK1 anticorps (Middle Region)

N° du produit ABIN632257

Détail du produit anti-ITPK1 anticorps

Antigène: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITPK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ITPK1 antibody was raised against the middle region of ITPK1

Purification: Affinity purified

Immunogène: ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITPK1 Blocking Peptide, catalog no. 33R-6637, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITPK1

Antigène: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Autre désignation: ITPK1 (ITPK1 Produits)

Synonymes: anticorps ITRPK1, anticorps BC031182, anticorps wu:fj15d08, anticorps zgc:56075, anticorps inositol-tetrakisphosphate 1-kinase, anticorps inositol 1,3,4-triphosphate 5/6 kinase, anticorps inositol-tetrakisphosphate 1-kinase L homeolog, anticorps inositol-tetrakisphosphate 1-kinase a, anticorps ITPK1, anticorps Itpk1, anticorps itpk1.L, anticorps itpk1a

Sujet: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.

Poids moléculaire: 45 kDa (MW of target protein)