ITPK1 anticorps (Middle Region)
-
- Antigène Voir toutes ITPK1 Anticorps
- ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ITPK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ITPK1 antibody was raised against the middle region of ITPK1
- Purification
- Affinity purified
- Immunogène
- ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI
- Top Product
- Discover our top product ITPK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ITPK1 Blocking Peptide, catalog no. 33R-6637, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))
- Autre désignation
- ITPK1 (ITPK1 Produits)
- Synonymes
- anticorps ITRPK1, anticorps BC031182, anticorps wu:fj15d08, anticorps zgc:56075, anticorps inositol-tetrakisphosphate 1-kinase, anticorps inositol 1,3,4-triphosphate 5/6 kinase, anticorps inositol-tetrakisphosphate 1-kinase L homeolog, anticorps inositol-tetrakisphosphate 1-kinase a, anticorps ITPK1, anticorps Itpk1, anticorps itpk1.L, anticorps itpk1a
- Sujet
- ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.
- Poids moléculaire
- 45 kDa (MW of target protein)
-