NCDN anticorps (N-Term)
-
- Antigène Voir toutes NCDN Anticorps
- NCDN (Neurochondrin (NCDN))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NCDN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Neurochondrin antibody was raised against the N terminal of NCDN
- Purification
- Affinity purified
- Immunogène
- Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS
- Top Product
- Discover our top product NCDN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Neurochondrin Blocking Peptide, catalog no. 33R-6403, is also available for use as a blocking control in assays to test for specificity of this Neurochondrin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCDN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NCDN (Neurochondrin (NCDN))
- Autre désignation
- Neurochondrin (NCDN Produits)
- Synonymes
- anticorps CG2330, anticorps Dmel\\CG2330, anticorps NCDN, anticorps GB14786, anticorps AU042419, anticorps MMS10-AE, anticorps Ms10ae, anticorps mKIAA0607, anticorps norbin, anticorps Norbin, anticorps CG2330 gene product from transcript CG2330-RA, anticorps neurochondrin, anticorps N-acylneuraminate-9-phosphatase, anticorps neurochondrin S homeolog, anticorps Neurochondrin, anticorps NCDN, anticorps LOC552430, anticorps ncdn, anticorps Ncdn, anticorps ncdn.S
- Sujet
- This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes.
- Poids moléculaire
- 79 kDa (MW of target protein)
-