NCDN anticorps (N-Term)

N° du produit ABIN632258

Détail du produit anti-NCDN anticorps

Antigène: NCDN (Neurochondrin (NCDN))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCDN est non-conjugé

Application: Western Blotting (WB)

Specificité: Neurochondrin antibody was raised against the N terminal of NCDN

Purification: Affinity purified

Immunogène: Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Neurochondrin Blocking Peptide, catalog no. 33R-6403, is also available for use as a blocking control in assays to test for specificity of this Neurochondrin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCDN

Antigène: NCDN (Neurochondrin (NCDN))

Autre désignation: Neurochondrin (NCDN Produits)

Synonymes: anticorps CG2330, anticorps Dmel\\CG2330, anticorps NCDN, anticorps GB14786, anticorps AU042419, anticorps MMS10-AE, anticorps Ms10ae, anticorps mKIAA0607, anticorps norbin, anticorps Norbin, anticorps CG2330 gene product from transcript CG2330-RA, anticorps neurochondrin, anticorps N-acylneuraminate-9-phosphatase, anticorps neurochondrin S homeolog, anticorps Neurochondrin, anticorps NCDN, anticorps LOC552430, anticorps ncdn, anticorps Ncdn, anticorps ncdn.S

Sujet: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes.

Poids moléculaire: 79 kDa (MW of target protein)