VTA1 anticorps

N° du produit ABIN632410

Détail du produit anti-VTA1 anticorps

Antigène: VTA1 (Vps20-Associated 1 Homolog (VTA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VTA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VTA1

Antigène: VTA1 (Vps20-Associated 1 Homolog (VTA1))

Autre désignation: VTA1 (VTA1 Produits)

Synonymes: anticorps C6orf55, anticorps DRG-1, anticorps DRG1, anticorps LIP5, anticorps My012, anticorps SBP1, anticorps 1110001D18Rik, anticorps 1110059P08Rik, anticorps AU040813, anticorps C85340, anticorps Lip5, anticorps RGD1305031, anticorps Vps20-associated 1 homolog, anticorps vesicle trafficking 1, anticorps vesicle (multivesicular body) trafficking 1, anticorps Vta1, anticorps VTA1

Sujet: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.

Poids moléculaire: 34 kDa (MW of target protein)