SYDE1 anticorps
-
- Antigène Voir toutes SYDE1 Anticorps
- SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SYDE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
- Top Product
- Discover our top product SYDE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SYDE1 Blocking Peptide, catalog no. 33R-7360, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYDE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))
- Autre désignation
- SYDE1 (SYDE1 Produits)
- Synonymes
- anticorps 7h3, anticorps 1200008N06Rik, anticorps BB043000, anticorps RGD1305857, anticorps synapse defective Rho GTPase homolog 1, anticorps synapse defective 1, Rho GTPase, homolog 1 (C. elegans), anticorps SYDE1, anticorps Syde1
- Sujet
- SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
- Poids moléculaire
- 80 kDa (MW of target protein)
-