DAPP1 anticorps (Middle Region)

N° du produit ABIN632442

Détail du produit anti-DAPP1 anticorps

Antigène: DAPP1 (Dual Adaptor of Phosphotyrosine and 3-phosphoinositides (DAPP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAPP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DAPP1 antibody was raised against the middle region of DAPP1

Purification: Affinity purified

Immunogène: DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAPP1 Blocking Peptide, catalog no. 33R-8628, is also available for use as a blocking control in assays to test for specificity of this DAPP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAPP1

Antigène: DAPP1 (Dual Adaptor of Phosphotyrosine and 3-phosphoinositides (DAPP1))

Autre désignation: DAPP1 (DAPP1 Produits)

Synonymes: anticorps BAM32, anticorps DAPP1, anticorps zgc:111998, anticorps bam32, anticorps Bam32, anticorps dual adaptor of phosphotyrosine and 3-phosphoinositides 1, anticorps dual adaptor of phosphotyrosine and 3-phosphoinositides, anticorps dual adaptor for phosphotyrosine and 3-phosphoinositides 1, anticorps DAPP1, anticorps Dapp1, anticorps dapp1

Sujet: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: BCR Signaling