PLEKHA1 anticorps (N-Term)
-
- Antigène Voir toutes PLEKHA1 Anticorps
- PLEKHA1 (Pleckstrin Homology Domain Containing, Family A (phosphoinositide Binding Specific) Member 1 (PLEKHA1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLEKHA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PLEKHA1 antibody was raised against the N terminal of PLEKHA1
- Purification
- Affinity purified
- Immunogène
- PLEKHA1 antibody was raised using the N terminal of PLEKHA1 corresponding to a region with amino acids LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ
- Top Product
- Discover our top product PLEKHA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLEKHA1 Blocking Peptide, catalog no. 33R-5226, is also available for use as a blocking control in assays to test for specificity of this PLEKHA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLEKHA1 (Pleckstrin Homology Domain Containing, Family A (phosphoinositide Binding Specific) Member 1 (PLEKHA1))
- Autre désignation
- PLEKHA1 (PLEKHA1 Produits)
- Synonymes
- anticorps RGD1564153, anticorps fc34a05, anticorps fc57h12, anticorps zgc:55676, anticorps wu:fc34a05, anticorps wu:fc57h12, anticorps MGC83674, anticorps PLEKHA1, anticorps DKFZp459M1025, anticorps TAPP1, anticorps AA960558, anticorps C920009D07Rik, anticorps pleckstrin homology domain containing A1, anticorps pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1a, anticorps pleckstrin homology domain containing A1 S homeolog, anticorps pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1, anticorps Plekha1, anticorps plekha1a, anticorps PLEKHA1, anticorps plekha1.S, anticorps plekha1
- Sujet
- PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-