CDCA7L anticorps (Middle Region)

N° du produit ABIN632453

Détail du produit anti-CDCA7L anticorps

Antigène: CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDCA7L est non-conjugé

Application: Western Blotting (WB)

Specificité: CDCA7 L antibody was raised against the middle region of CDCA7

Purification: Affinity purified

Immunogène: CDCA7 L antibody was raised using the middle region of CDCA7 corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDCA7L Blocking Peptide, catalog no. 33R-7245, is also available for use as a blocking control in assays to test for specificity of this CDCA7L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDCA7L

Antigène: CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))

Autre désignation: CDCA7L (CDCA7L Produits)

Synonymes: anticorps ram2, anticorps MGC154777, anticorps BC006933, anticorps JPO2, anticorps R1, anticorps RAM2, anticorps RAPGEF5, anticorps cell division cycle associated 7 like, anticorps cell division cycle associated 7 like L homeolog, anticorps cell division cycle-associated 7-like protein, anticorps CDCA7L, anticorps cdca7l.L, anticorps LOC100454683, anticorps Cdca7l

Sujet: CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.

Poids moléculaire: 46 kDa (MW of target protein)