TWF1 anticorps
-
- Antigène Voir toutes TWF1 Anticorps
- TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TWF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TWF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD
- Top Product
- Discover our top product TWF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TWF1 Blocking Peptide, catalog no. 33R-6441, is also available for use as a blocking control in assays to test for specificity of this TWF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TWF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))
- Autre désignation
- TWF1 (TWF1 Produits)
- Synonymes
- anticorps A6, anticorps PTK9, anticorps Ptk9, anticorps twinfilin, anticorps ptk9, anticorps twf1, anticorps wu:fd02b03, anticorps zgc:65922, anticorps DKFZp469O1925, anticorps CG3771, anticorps Dmel\\CG3771, anticorps EG:9D2.3, anticorps zgc:92472, anticorps twinfilin actin binding protein 1, anticorps twinfilin actin-binding protein 1a, anticorps twinfilin actin binding protein 1 S homeolog, anticorps twinfilin-1, anticorps hypothetical protein, anticorps Twinfilin-1, anticorps twinfilin actin-binding protein 1, anticorps CG3771 gene product from transcript CG3771-RC, anticorps twinfilin actin-binding protein 1b, anticorps TWF1, anticorps Twf1, anticorps twf1a, anticorps twf1.S, anticorps PTRG_09288, anticorps PGTG_01788, anticorps Tsp_02530, anticorps twf1, anticorps a6, anticorps twf1b
- Sujet
- This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization, Maintenance of Protein Location
-