TWF1 anticorps

N° du produit ABIN632468

Détail du produit anti-TWF1 anticorps

Antigène: TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TWF1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TWF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TWF1 Blocking Peptide, catalog no. 33R-6441, is also available for use as a blocking control in assays to test for specificity of this TWF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TWF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TWF1

Antigène: TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))

Autre désignation: TWF1 (TWF1 Produits)

Synonymes: anticorps A6, anticorps PTK9, anticorps Ptk9, anticorps twinfilin, anticorps ptk9, anticorps twf1, anticorps wu:fd02b03, anticorps zgc:65922, anticorps DKFZp469O1925, anticorps CG3771, anticorps Dmel\\CG3771, anticorps EG:9D2.3, anticorps zgc:92472, anticorps twinfilin actin binding protein 1, anticorps twinfilin actin-binding protein 1a, anticorps twinfilin actin binding protein 1 S homeolog, anticorps twinfilin-1, anticorps hypothetical protein, anticorps Twinfilin-1, anticorps twinfilin actin-binding protein 1, anticorps CG3771 gene product from transcript CG3771-RC, anticorps twinfilin actin-binding protein 1b, anticorps TWF1, anticorps Twf1, anticorps twf1a, anticorps twf1.S, anticorps PTRG_09288, anticorps PGTG_01788, anticorps Tsp_02530, anticorps twf1, anticorps a6, anticorps twf1b

Sujet: This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Maintenance of Protein Location