PLEKHA9 anticorps
-
- Antigène Tous les produits PLEKHA9
- PLEKHA9 (Pleckstrin Homology Domain Containing, Family A (Phosphoinositide Binding Specific) Member 9 (PLEKHA9))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLEKHA9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PLEKHA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLEKHA9 Blocking Peptide, catalog no. 33R-2267, is also available for use as a blocking control in assays to test for specificity of this PLEKHA9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHA9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLEKHA9 (Pleckstrin Homology Domain Containing, Family A (Phosphoinositide Binding Specific) Member 9 (PLEKHA9))
- Autre désignation
- PLEKHA9 (PLEKHA9 Produits)
- Synonymes
- anticorps PLEKHA9, anticorps pleckstrin homology domain containing A8 pseudogene 1, anticorps PLEKHA8P1
- Sujet
- The function of PLEKHA9 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 43 kDa (MW of target protein)
-