RSL24D1 anticorps (Middle Region)

N° du produit ABIN632474

Détail du produit anti-RSL24D1 anticorps

Antigène: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSL24D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C15 ORF15 antibody was raised against the middle region of C15 rf15

Purification: Affinity purified

Immunogène: C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED

Information d'application

Indications d'application: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C15ORF15 Blocking Peptide, catalog no. 33R-2931, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSL24D1

Antigène: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Autre désignation: C15ORF15 (RSL24D1 Produits)

Synonymes: anticorps C15orf15, anticorps HRP-L30-iso, anticorps L30, anticorps RLP24, anticorps RPL24, anticorps RPL24L, anticorps TVAS3, anticorps 2410159K22Rik, anticorps RGD1309784, anticorps c15orf15, anticorps wu:fa94f12, anticorps wu:fa95d02, anticorps zgc:56202, anticorps ribosomal L24 domain containing 1, anticorps RSL24D1, anticorps Rsl24d1, anticorps rsl24d1

Sujet: The function of Chromosome 15 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 19 kDa (MW of target protein)