CST8 anticorps

N° du produit ABIN632480

Détail du produit anti-CST8 anticorps

Antigène: CST8 (Cystatin 8 (CST8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CST8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Cystatin 8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cystatin 8 Blocking Peptide, catalog no. 33R-5097, is also available for use as a blocking control in assays to test for specificity of this Cystatin 8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CST8

Antigène: CST8 (Cystatin 8 (CST8))

Autre désignation: Cystatin 8 (CST8 Produits)

Synonymes: anticorps CRES, anticorps CTES5, anticorps Cres, anticorps Cst-rs1, anticorps cystatin 8, anticorps cystatin 8 (cystatin-related epididymal spermatogenic), anticorps CST8, anticorps Cst8

Sujet: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens.

Poids moléculaire: 14 kDa (MW of target protein)