GPR87 anticorps (N-Term)
-
- Antigène Voir toutes GPR87 Anticorps
- GPR87 (G Protein-Coupled Receptor 87 (GPR87))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPR87 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPR87 antibody was raised against the N terminal of GPR87
- Purification
- Affinity purified
- Immunogène
- GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL
- Top Product
- Discover our top product GPR87 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPR87 Blocking Peptide, catalog no. 33R-6027, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR87 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPR87 (G Protein-Coupled Receptor 87 (GPR87))
- Autre désignation
- GPR87 (GPR87 Produits)
- Synonymes
- anticorps GPR95, anticorps KPG_002, anticorps G protein-coupled receptor 87, anticorps GPR87, anticorps Gpr87
- Sujet
- G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-