TCP11 anticorps
-
- Antigène Voir toutes TCP11 Anticorps
- TCP11 (T-Complex 11, Testis-Specific (TCP11))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TCP11 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL
- Top Product
- Discover our top product TCP11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TCP11 Blocking Peptide, catalog no. 33R-1827, is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TCP11 (T-Complex 11, Testis-Specific (TCP11))
- Autre désignation
- TCP11 (TCP11 Produits)
- Synonymes
- anticorps D6S230E, anticorps FPPR, anticorps D17Ken1, anticorps Tcp-11, anticorps t-complex 11, anticorps t-complex protein 11, anticorps Tcp11, anticorps TCP11
- Sujet
- TCP11 may play an important role in sperm function and fertility.
- Poids moléculaire
- 49 kDa (MW of target protein)
-