LDHAL6B anticorps (Middle Region)

N° du produit ABIN632531

Détail du produit anti-LDHAL6B anticorps

Antigène: LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LDHAL6B est non-conjugé

Application: Western Blotting (WB)

Specificité: LDHAL6 B antibody was raised against the middle region of LDHAL6

Purification: Affinity purified

Immunogène: LDHAL6 B antibody was raised using the middle region of LDHAL6 corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDHAL6B Blocking Peptide, catalog no. 33R-8500, is also available for use as a blocking control in assays to test for specificity of this LDHAL6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHAL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LDHAL6B

Antigène: LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))

Autre désignation: LDHAL6B (LDHAL6B Produits)

Synonymes: anticorps Ldhl, anticorps LDHL, anticorps Ldhal, anticorps AI326310, anticorps 4933402O15Rik, anticorps LDHAL6B, anticorps LDH6B, anticorps LDHAL6, anticorps lactate dehydrogenase A-like 6B, anticorps lactate dehydrogenase A like 6B, anticorps Ldhal6b, anticorps LDHAL6B

Sujet: The function of LDH protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)