CLUL1 anticorps

N° du produit ABIN632549

Détail du produit anti-CLUL1 anticorps

Antigène: CLUL1 (Clusterin-Like 1 (Retinal) (CLUL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLUL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Clusterin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Clusterin-Like 1 Blocking Peptide, catalog no. 33R-9042, is also available for use as a blocking control in assays to test for specificity of this Clusterin-Like 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLUL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLUL1

Antigène: CLUL1 (Clusterin-Like 1 (Retinal) (CLUL1))

Abstract: CLUL1 Produits

Synonymes: anticorps RA337M, anticorps clusterin like 1, anticorps CLUL1, anticorps Clul1

Sujet: CLUL1 is a secreted clusterin family glycoprotein that is expressed predominantly by cone photoreceptors of the retina. CLUL1 expression is downregulated in some forms of retinal disease.

Poids moléculaire: 54 kDa (MW of target protein)