SRR anticorps (Middle Region)

N° du produit ABIN632556

Détail du produit anti-SRR anticorps

Antigène: SRR (Serine Racemase (SRR))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRR est non-conjugé

Application: Western Blotting (WB)

Specificité: SRR antibody was raised against the middle region of SRR

Purification: Affinity purified

Immunogène: SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRR Blocking Peptide, catalog no. 33R-3639, is also available for use as a blocking control in assays to test for specificity of this SRR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRR

Antigène: SRR (Serine Racemase (SRR))

Autre désignation: SRR (SRR Produits)

Synonymes: anticorps DDBDRAFT_0188432, anticorps DDBDRAFT_0230209, anticorps DDB_0188432, anticorps DDB_0230209, anticorps ilv1, anticorps iso1, anticorps ILV1, anticorps ISO1, anticorps Srs, anticorps serine racemase, anticorps Serine racemase, anticorps SRR, anticorps srr, anticorps NGR_b19540, anticorps ZPR_3642, anticorps MGYG_07950, anticorps Halhy_2637, anticorps Runsl_3290, anticorps Srr

Sujet: SRR catalyzes the synthesis of D-serine from L-serine.

Poids moléculaire: 36 kDa (MW of target protein)