AGGF1 anticorps (Middle Region)

N° du produit ABIN632559

Détail du produit anti-AGGF1 anticorps

Antigène: AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGGF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AGGF1 antibody was raised against the middle region of AGGF1

Purification: Affinity purified

Immunogène: AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGGF1 Blocking Peptide, catalog no. 33R-2818, is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGGF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGGF1

Antigène: AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))

Autre désignation: AGGF1 (AGGF1 Produits)

Synonymes: anticorps RGD1310888, anticorps AGGF1, anticorps LOC100037685, anticorps im:7146636, anticorps zgc:152959, anticorps DKFZp459G1317, anticorps GPATC7, anticorps GPATCH7, anticorps HSU84971, anticorps HUS84971, anticorps VG5Q, anticorps 2010009L17Rik, anticorps 2310029P06Rik, anticorps AW112072, anticorps Peg3, anticorps angiogenic factor with G patch and FHA domains 1, anticorps angiogenic factor with G-patch and FHA domains 1, anticorps Aggf1, anticorps AGGF1, anticorps aggf1, anticorps CC1G_06398

Sujet: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.

Poids moléculaire: 81 kDa (MW of target protein)