CCBE1 anticorps (Middle Region)

N° du produit ABIN632573

L’anticorps anti-CCBE1 Polyclonal Lapin est utilisé pour la détection de CCBE1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour CCBE1 anticorps (Middle Region) (ABIN632573)

Antigène: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCBE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCBE1 anticorps

Épitope: Middle Region

Specificité: CCBE1 antibody was raised against the middle region of CCBE1

Purification: Affinity purified

Immunogène: CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCBE1 Blocking Peptide, (ABIN5612702), is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCBE1

Antigène: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Autre désignation: CCBE1

Sujet: This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.

Poids moléculaire: 44 kDa (MW of target protein)