CCBE1 anticorps (Middle Region)

N° du produit ABIN632573

Détail du produit anti-CCBE1 anticorps

Antigène: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCBE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCBE1 antibody was raised against the middle region of CCBE1

Purification: Affinity purified

Immunogène: CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCBE1 Blocking Peptide, catalog no. 33R-7221, is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCBE1

Antigène: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Autre désignation: CCBE1 (CCBE1 Produits)

Synonymes: anticorps 4933426F18Rik, anticorps 9430093N24Rik, anticorps mKIAA1983, anticorps RGD1307670, anticorps fof, anticorps collagen and calcium binding EGF domains 1, anticorps CCBE1, anticorps Ccbe1, anticorps ccbe1

Sujet: This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.

Poids moléculaire: 44 kDa (MW of target protein)