PDYN anticorps (Middle Region)

N° du produit ABIN632594

Détail du produit anti-PDYN anticorps

Antigène: PDYN (Prodynorphin (PDYN))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDYN est non-conjugé

Application: Western Blotting (WB)

Specificité: Prodynorphin antibody was raised against the middle region of PDYN

Purification: Affinity purified

Immunogène: Prodynorphin antibody was raised using the middle region of PDYN corresponding to a region with amino acids SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Prodynorphin Blocking Peptide, catalog no. 33R-8391, is also available for use as a blocking control in assays to test for specificity of this Prodynorphin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDYN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDYN

Antigène: PDYN (Prodynorphin (PDYN))

Autre désignation: Prodynorphin (PDYN Produits)

Synonymes: anticorps pdyn, anticorps ADCA, anticorps PENKB, anticorps SCA23, anticorps Dyn, anticorps OLPB, anticorps olpa, anticorps XOLPA, anticorps penkb, anticorps Xen-dorphin, anticorps olpb, anticorps XOLPB, anticorps wu:fj38c03, anticorps PDYN, anticorps prodynorphin, anticorps prodynorphin L homeolog, anticorps prodynorphin S homeolog, anticorps pdyn, anticorps PDYN, anticorps Pdyn, anticorps pdyn.L, anticorps pdyn.S

Sujet: The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 27 kDa (MW of target protein)