GSTK1 anticorps (Middle Region)

N° du produit ABIN632597

Détail du produit anti-GSTK1 anticorps

Antigène: GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTK1 antibody was raised against the middle region of GSTK1

Purification: Affinity purified

Immunogène: GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTK1 Blocking Peptide, catalog no. 33R-6755, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTK1

Antigène: GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))

Autre désignation: GSTK1 (GSTK1 Produits)

Synonymes: anticorps gst13-13, anticorps GSTK1, anticorps gstk1, anticorps DKFZp459M1330, anticorps GST, anticorps GST 13-13, anticorps GST13, anticorps GST13-13, anticorps GSTK1-1, anticorps hGSTK1, anticorps 0610025I19Rik, anticorps AW260476, anticorps DsbA-L, anticorps GSTkappa, anticorps glutathione S-transferase kappa 1 L homeolog, anticorps glutathione S-transferase kappa 1, anticorps Glutathione S-transferase kappa 1, anticorps gstk1.L, anticorps GSTK1, anticorps gstk1, anticorps PTRG_07256, anticorps Gstk1, anticorps LOC100350399

Sujet: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Poids moléculaire: 25 kDa (MW of target protein)