CRY2 anticorps

N° du produit ABIN632607

Détail du produit anti-CRY2 anticorps

Antigène: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRY2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cryptochrome 2 Blocking Peptide, catalog no. 33R-3945, is also available for use as a blocking control in assays to test for specificity of this Cryptochrome 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRY2

Antigène: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Autre désignation: Cryptochrome 2 (CRY2 Produits)

Synonymes: anticorps Cry2, anticorps Cry, anticorps GB10211, anticorps CRY2, anticorps AT-PHH1, anticorps ATCRY2, anticorps CRYPTOCHROME 2 APOPROTEIN, anticorps F19P19.14, anticorps F19P19_14, anticorps FHA, anticorps PHH1, anticorps cryptochrome 2, anticorps HCRY2, anticorps PHLL2, anticorps AV006279, anticorps D130054K12Rik, anticorps gCry2, anticorps cryptochrome circadian regulator 2, anticorps cryptochrome 2, anticorps cryptochrome Cry2, anticorps cryptochrome circadian clock 2, anticorps cryptochrome 2 (photolyase-like), anticorps CRY2, anticorps Cry2, anticorps cry2, anticorps LOC100502533

Sujet: CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Protein targeting to Nucleus