TINAGL1 anticorps (Middle Region)
-
- Antigène Voir toutes TINAGL1 Anticorps
- TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TINAGL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TINAGL1 antibody was raised against the middle region of TINAGL1
- Purification
- Affinity purified
- Immunogène
- TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT
- Top Product
- Discover our top product TINAGL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TINAGL1 Blocking Peptide, catalog no. 33R-6759, is also available for use as a blocking control in assays to test for specificity of this TINAGL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAGL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))
- Autre désignation
- TINAGL1 (TINAGL1 Produits)
- Synonymes
- anticorps ARG1, anticorps LCN7, anticorps LIECG3, anticorps TINAGRP, anticorps 1110021J17Rik, anticorps AZ-1, anticorps AZ1, anticorps Arg1, anticorps Lcn7, anticorps TARP, anticorps Tinagl, anticorps gis5, anticorps tubulointerstitial nephritis antigen like 1, anticorps tubulointerstitial nephritis antigen-like 1, anticorps TINAGL1, anticorps Tinagl1
- Sujet
- TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.
- Poids moléculaire
- 52 kDa (MW of target protein)
-