TINAGL1 anticorps (Middle Region)

N° du produit ABIN632612

Détail du produit anti-TINAGL1 anticorps

Antigène: TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TINAGL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TINAGL1 antibody was raised against the middle region of TINAGL1

Purification: Affinity purified

Immunogène: TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TINAGL1 Blocking Peptide, catalog no. 33R-6759, is also available for use as a blocking control in assays to test for specificity of this TINAGL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAGL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TINAGL1

Antigène: TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))

Autre désignation: TINAGL1 (TINAGL1 Produits)

Synonymes: anticorps ARG1, anticorps LCN7, anticorps LIECG3, anticorps TINAGRP, anticorps 1110021J17Rik, anticorps AZ-1, anticorps AZ1, anticorps Arg1, anticorps Lcn7, anticorps TARP, anticorps Tinagl, anticorps gis5, anticorps tubulointerstitial nephritis antigen like 1, anticorps tubulointerstitial nephritis antigen-like 1, anticorps TINAGL1, anticorps Tinagl1

Sujet: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Poids moléculaire: 52 kDa (MW of target protein)