ADPRM anticorps (Middle Region)
-
- Antigène Voir toutes ADPRM (C17orf48) Anticorps
- ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADPRM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C17 ORF48 antibody was raised against the middle region of C17 rf48
- Purification
- Affinity purified
- Immunogène
- C17 ORF48 antibody was raised using the middle region of C17 rf48 corresponding to a region with amino acids KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF
- Top Product
- Discover our top product C17orf48 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C17ORF48 Blocking Peptide, catalog no. 33R-4738, is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Mapping epitopes of U1-70K autoantibodies at single-amino acid resolution." dans: Autoimmunity, Vol. 48, Issue 8, pp. 513-23, (2016) (PubMed).
: "
-
Mapping epitopes of U1-70K autoantibodies at single-amino acid resolution." dans: Autoimmunity, Vol. 48, Issue 8, pp. 513-23, (2016) (PubMed).
-
- Antigène
- ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))
- Autre désignation
- C17ORF48 (C17orf48 Produits)
- Synonymes
- anticorps 2310004I24Rik, anticorps MDS006, anticorps C17orf48, anticorps NBLA03831, anticorps C19H17orf48, anticorps ADPRibase-Mn, anticorps RGD1309906, anticorps c17orf48, anticorps mds006, anticorps ADP-ribose/CDP-alcohol diphosphatase, manganese dependent, anticorps ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent, anticorps ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent L homeolog, anticorps Adprm, anticorps ADPRM, anticorps adprm.L
- Sujet
- The C17ORF48 protein hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.
- Poids moléculaire
- 39 kDa (MW of target protein)
-