GM2A anticorps (N-Term)
-
- Antigène Voir toutes GM2A Anticorps
- GM2A (GM2 Ganglioside Activator (GM2A))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GM2A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GM2 A antibody was raised against the N terminal of GM2
- Purification
- Affinity purified
- Immunogène
- GM2 A antibody was raised using the N terminal of GM2 corresponding to a region with amino acids MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS
- Top Product
- Discover our top product GM2A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GM2A Blocking Peptide, catalog no. 33R-6345, is also available for use as a blocking control in assays to test for specificity of this GM2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GM2A (GM2 Ganglioside Activator (GM2A))
- Autre désignation
- GM2A (GM2A Produits)
- Synonymes
- anticorps GM2A, anticorps fb96e04, anticorps fb96e10, anticorps wu:fb96e04, anticorps wu:fb96e10, anticorps zgc:110188, anticorps MGC84154, anticorps GM2-AP, anticorps SAP-3, anticorps AA408702, anticorps AW215435, anticorps GM2 ganglioside activator, anticorps GM2 ganglioside activator L homeolog, anticorps GM2 ganglioside activator protein, anticorps Gm2a, anticorps GM2A, anticorps gm2a, anticorps gm2a.L
- Sujet
- This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the gangliosid.
- Poids moléculaire
- 18 kDa (MW of target protein)
-