C2orf47 anticorps (Middle Region)
-
- Antigène Tous les produits C2orf47
- C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C2orf47 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C2 ORF47 antibody was raised against the middle region of C2 rf47
- Purification
- Affinity purified
- Immunogène
- C2 ORF47 antibody was raised using the middle region of C2 rf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C2ORF47 Blocking Peptide, catalog no. 33R-3173, is also available for use as a blocking control in assays to test for specificity of this C2ORF47 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF47 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))
- Autre désignation
- C2ORF47 (C2orf47 Produits)
- Synonymes
- anticorps C12H2orf47, anticorps C2orf47, anticorps chromosome 7 open reading frame, human C2orf47, anticorps matrix AAA peptidase interacting protein 1, anticorps matrix AAA peptidase interacting protein 1 L homeolog, anticorps C7H2ORF47, anticorps MAIP1, anticorps maip1, anticorps maip1.L
- Sujet
- The function of the C2orf47 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 32 kDa (MW of target protein)
-