C2orf47 anticorps (Middle Region)

N° du produit ABIN632673

Détail du produit anti-C2orf47 anticorps

Antigène: C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C2orf47 est non-conjugé

Application: Western Blotting (WB)

Specificité: C2 ORF47 antibody was raised against the middle region of C2 rf47

Purification: Affinity purified

Immunogène: C2 ORF47 antibody was raised using the middle region of C2 rf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2ORF47 Blocking Peptide, catalog no. 33R-3173, is also available for use as a blocking control in assays to test for specificity of this C2ORF47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C2orf47

Antigène: C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))

Autre désignation: C2ORF47 (C2orf47 Produits)

Synonymes: anticorps C12H2orf47, anticorps C2orf47, anticorps chromosome 7 open reading frame, human C2orf47, anticorps matrix AAA peptidase interacting protein 1, anticorps matrix AAA peptidase interacting protein 1 L homeolog, anticorps C7H2ORF47, anticorps MAIP1, anticorps maip1, anticorps maip1.L

Sujet: The function of the C2orf47 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 32 kDa (MW of target protein)