PGAM2 anticorps

N° du produit ABIN632675

Détail du produit anti-PGAM2 anticorps

Antigène: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGAM2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGAM2 Blocking Peptide, catalog no. 33R-5774, is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGAM2

Antigène: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Autre désignation: PGAM2 (PGAM2 Produits)

Synonymes: anticorps zgc:63876, anticorps GSD10, anticorps PGAM-M, anticorps PGAMM, anticorps D14Mgh1, anticorps Pgmut, anticorps phosphoglycerate mutase 2, anticorps phosphoglycerate mutase 2 (muscle), anticorps phosphoglycerate mutase 2 L homeolog, anticorps Pgam2, anticorps PGAM2, anticorps pgam2, anticorps pgam2.L

Sujet: PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Poids moléculaire: 29 kDa (MW of target protein)