PGAM2 anticorps

N° du produit ABIN632675

L’anticorps anti-PGAM2 Polyclonal Lapin est utilisé pour la détection de PGAM2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PGAM2 anticorps (ABIN632675)

Antigène: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGAM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PGAM2 anticorps

Purification: Affinity purified

Immunogène: PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGAM2 Blocking Peptide, (ABIN5615328), is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGAM2

Antigène: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Autre désignation: PGAM2

Sujet: PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Poids moléculaire: 29 kDa (MW of target protein)