MTHFS anticorps
-
- Antigène Voir toutes MTHFS Anticorps
- MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTHFS est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
- Top Product
- Discover our top product MTHFS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MTHFS Blocking Peptide, catalog no. 33R-9307, is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))
- Autre désignation
- MTHFS (MTHFS Produits)
- Synonymes
- anticorps MTHFS, anticorps 1110034I12Rik, anticorps 2310020H23Rik, anticorps AI119695, anticorps HsT19268, anticorps 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase), anticorps methenyltetrahydrofolate synthetase, anticorps 5-formyltetrahydrofolate cyclo-ligase (predicted), anticorps 5-formyltetrahydrofolate cyclo-ligase, anticorps 5, 10-methenyltetrahydrofolate synthetase, anticorps MTHFS, anticorps SPBC1703.08c, anticorps ZMO0215, anticorps LBA1507, anticorps Rxyl_1321, anticorps MEMAR_RS07640, anticorps Mjls_4669, anticorps STROP_RS03755, anticorps Mext_0779, anticorps AMF_RS07350, anticorps CKC_02040, anticorps Mthfs
- Sujet
- MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.
- Poids moléculaire
- 23 kDa (MW of target protein)
-