GALM anticorps
-
- Antigène Voir toutes GALM Anticorps
- GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GALM est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
- Top Product
- Discover our top product GALM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GALM Blocking Peptide, catalog no. 33R-9947, is also available for use as a blocking control in assays to test for specificity of this GALM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))
- Autre désignation
- GALM (GALM Produits)
- Synonymes
- anticorps GALM, anticorps A530057M15Rik, anticorps AU015645, anticorps AU020959, anticorps MUT, anticorps IBD1, anticorps galactose mutarotase, anticorps galactose mutarotase (aldose 1-epimerase), anticorps Aldose-1-epimerase (Galactose mutarotase), anticorps galactose mutarotase (aldose 1-epimerase) L homeolog, anticorps GALM, anticorps galm, anticorps galM, anticorps galm.L, anticorps Ping_2018, anticorps BRADO1815, anticorps BBta_2135, anticorps Spro_1290, anticorps PC1_1264, anticorps Dd586_1213, anticorps Kvar_3617, anticorps AOLE_14520, anticorps Entcl_3074, anticorps Pat9b_1148, anticorps Rahaq_3123, anticorps Ccan_05570, anticorps Galm
- Sujet
- GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
- Poids moléculaire
- 38 kDa (MW of target protein)
-