CPNE9 anticorps (Middle Region)

N° du produit ABIN632764

Détail du produit anti-CPNE9 anticorps

Antigène: CPNE9 (Copine IX (CPNE9))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPNE9 est non-conjugé

Application: Western Blotting (WB)

Specificité: Copine IX antibody was raised against the middle region of CPNE9

Purification: Affinity purified

Immunogène: Copine IX antibody was raised using the middle region of CPNE9 corresponding to a region with amino acids YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Copine IX Blocking Peptide, catalog no. 33R-10075, is also available for use as a blocking control in assays to test for specificity of this Copine IX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPNE9

Antigène: CPNE9 (Copine IX (CPNE9))

Autre désignation: Copine IX (CPNE9 Produits)

Synonymes: anticorps A730016F12Rik, anticorps mKIAA4217, anticorps RGD1309212, anticorps copine family member 9, anticorps copine family member IX, anticorps CPNE9, anticorps Cpne9

Sujet: CPNE9 may function in membrane trafficking. It exhibits calcium-dependent phospholipid binding properties.

Poids moléculaire: 62 kDa (MW of target protein)