HSPE1 anticorps

N° du produit ABIN632792

Détail du produit anti-HSPE1 anticorps

Antigène: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPE1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPE1 Blocking Peptide, catalog no. 33R-3360, is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPE1

Antigène: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Autre désignation: HSPE1 (HSPE1 Produits)

Synonymes: anticorps CPN10, anticorps EPF, anticorps GROES, anticorps HSP10, anticorps groS, anticorps Cpn10, anticorps cpn10, anticorps zgc:86747, anticorps hspe1, anticorps MGC89647, anticorps HSPE1, anticorps MITOCHONDRIAL CHAPERONIN 10, anticorps T15D22.2, anticorps T15D22_2, anticorps chaperonin 10, anticorps Dmel\\CG11267, anticorps Hsp10, anticorps anon-WO0118547.175, anticorps hsp10, anticorps crpB, anticorps chpS, anticorps 10kDa, anticorps mt-cpn10, anticorps heat shock protein family E (Hsp10) member 1, anticorps molecular chaperone GroES, anticorps chaperonin 10 kDa, anticorps chaperonin, 10 kDa, anticorps chaperonin-10 kDa, anticorps heat shock protein family E member 1, anticorps heat shock 10 protein 1, anticorps heat shock protein family E (Hsp10) member 1 L homeolog, anticorps heat shock 10kDa protein 1 (chaperonin 10) pseudogene, anticorps 10 kd chaperonin, anticorps chaperonin 10, anticorps Hsp10p, anticorps co-chaperonin 10, mitochondrial, anticorps CG11267 gene product from transcript CG11267-RA, anticorps co-chaperonin GroES, anticorps mitochondrial heat shock protein Hsp10 (predicted), anticorps chaperonin GroS, anticorps Hsp10 10 kDa chaperonin GROES, anticorps mitochondrial heat shock protein Hsp10, anticorps heat shock protein 10, anticorps heat shock protein 1 (chaperonin 10), anticorps heat shock 10kDa protein 1 (chaperonin 10), anticorps HSPE1, anticorps groES, anticorps groES2, anticorps TP01_0190, anticorps Cag_1167, anticorps Bm1_56470, anticorps Hspe1, anticorps hspe1, anticorps hspe1.L, anticorps LOC452179, anticorps Cpn10, anticorps CPN10, anticorps HSP10, anticorps CG11267, anticorps hsp10, anticorps groS

Sujet: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Poids moléculaire: 11 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity