PPWD1 anticorps (Middle Region)

N° du produit ABIN632810

L’anticorps anti-PPWD1 Polyclonal Lapin est utilisé pour la détection de PPWD1 dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour PPWD1 anticorps (Middle Region) (ABIN632810)

Antigène: PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPWD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPWD1 anticorps

Épitope: Middle Region

Specificité: PPWD1 antibody was raised against the middle region of PPWD1

Purification: Affinity purified

Immunogène: PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPWD1 Blocking Peptide, (ABIN938384), is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPWD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPWD1

Antigène: PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))

Autre désignation: PPWD1

Sujet: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Poids moléculaire: 73 kDa (MW of target protein)