PPWD1 anticorps (Middle Region)
-
- Antigène Voir toutes PPWD1 Anticorps
- PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPWD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PPWD1 antibody was raised against the middle region of PPWD1
- Purification
- Affinity purified
- Immunogène
- PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG
- Top Product
- Discover our top product PPWD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPWD1 Blocking Peptide, catalog no. 33R-2998, is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPWD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))
- Autre désignation
- PPWD1 (PPWD1 Produits)
- Synonymes
- anticorps zgc:165355, anticorps 4632422M10Rik, anticorps A330090G21Rik, anticorps RGD1310204, anticorps peptidylprolyl isomerase domain and WD repeat containing 1, anticorps peptidylprolyl isomerase domain and WD repeat containing 1 S homeolog, anticorps PPWD1, anticorps ppwd1, anticorps ppwd1.S, anticorps Ppwd1
- Sujet
- PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.
- Poids moléculaire
- 73 kDa (MW of target protein)
-