AAMDC anticorps (Middle Region)

N° du produit ABIN632818

Détail du produit anti-AAMDC anticorps

Antigène: AAMDC (Adipogenesis Associated Mth938 Domain Containing (AAMDC))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AAMDC est non-conjugé

Application: Western Blotting (WB)

Specificité: C11 ORF67 antibody was raised against the middle region of C11 rf67

Purification: Affinity purified

Immunogène: C11 ORF67 antibody was raised using the middle region of C11 rf67 corresponding to a region with amino acids SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF67 Blocking Peptide, catalog no. 33R-8383, is also available for use as a blocking control in assays to test for specificity of this C11ORF67 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF67 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AAMDC

Antigène: AAMDC (Adipogenesis Associated Mth938 Domain Containing (AAMDC))

Autre désignation: C11ORF67 (AAMDC Produits)

Synonymes: anticorps C11orf67, anticorps C29H11orf67, anticorps c11orf67, anticorps zgc:112239, anticorps CK067, anticorps RGD1561459, anticorps 1810020D17Rik, anticorps 1810037D19Rik, anticorps LI2, anticorps adipogenesis associated Mth938 domain containing, anticorps adipogenesis associated, Mth938 domain containing, anticorps AAMDC, anticorps aamdc, anticorps Aamdc

Sujet: The function of C11orf67 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 13 kDa (MW of target protein)