HARBI1 anticorps (Middle Region)

N° du produit ABIN632839

Détail du produit anti-HARBI1 anticorps

Antigène: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Épitope: Middle Region

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HARBI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C11 ORF77 antibody was raised against the middle region of C11 rf77

Purification: Affinity purified

Immunogène: C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF77 Blocking Peptide, catalog no. 33R-3645, is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HARBI1

Antigène: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Autre désignation: C11ORF77 (HARBI1 Produits)

Synonymes: anticorps C11orf77, anticorps C15H11orf77, anticorps D230010M03Rik, anticorps flj32675, anticorps zgc:91866, anticorps harbinger transposase derived 1, anticorps HARBI1, anticorps Harbi1, anticorps harbi1

Sujet: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)