HARBI1 anticorps (Middle Region)

N° du produit ABIN632839

Cet anticorps Lapin Polyclonal détecte spécifiquement HARBI1 dans WB. Il présente une réactivité avec des échantillons de Souris, Humain et Rat.

Aperçu rapide pour HARBI1 anticorps (Middle Region) (ABIN632839)

Antigène: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HARBI1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HARBI1 anticorps

Épitope: Middle Region

Specificité: C11 ORF77 antibody was raised against the middle region of C11 rf77

Purification: Affinity purified

Immunogène: C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF77 Blocking Peptide, (ABIN939031), is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HARBI1

Antigène: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Autre désignation: C11ORF77

Sujet: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)