MIER2 anticorps (Middle Region)

N° du produit ABIN632926

Détail du produit anti-MIER2 anticorps

Antigène: MIER2 (Mesoderm Induction Early Response 1, Family Member 2 (MIER2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MIER2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MIER2 antibody was raised against the middle region of MIER2

Purification: Affinity purified

Immunogène: MIER2 antibody was raised using the middle region of MIER2 corresponding to a region with amino acids RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MIER2 Blocking Peptide, catalog no. 33R-8048, is also available for use as a blocking control in assays to test for specificity of this MIER2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MIER2

Antigène: MIER2 (Mesoderm Induction Early Response 1, Family Member 2 (MIER2))

Autre désignation: MIER2 (MIER2 Produits)

Synonymes: anticorps KIAA1193, anticorps Mi-er2, anticorps 2700087H15Rik, anticorps mKIAA1193, anticorps RGD1307278, anticorps mesoderm induction early response 1, family member 2 S homeolog, anticorps mesoderm induction early response 1, family member 2, anticorps MIER family member 2, anticorps mier2.S, anticorps mier2, anticorps MIER2, anticorps Mier2

Sujet: MIER2 is a transcriptional repressor.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Chromatin Binding