SPATA7 anticorps (Middle Region)

N° du produit ABIN632947

Détail du produit anti-SPATA7 anticorps

Antigène: SPATA7 (Spermatogenesis Associated 7 (SPATA7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA7 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA7 antibody was raised against the middle region of SPATA7

Purification: Affinity purified

Immunogène: SPATA7 antibody was raised using the middle region of SPATA7 corresponding to a region with amino acids FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA7 Blocking Peptide, catalog no. 33R-2989, is also available for use as a blocking control in assays to test for specificity of this SPATA7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA7

Antigène: SPATA7 (Spermatogenesis Associated 7 (SPATA7))

Autre désignation: SPATA7 (SPATA7 Produits)

Synonymes: anticorps HSD-3.1, anticorps HSD3, anticorps LCA3, anticorps AI661438, anticorps B230306G18Rik, anticorps RSD-3, anticorps Wmp1, anticorps spermatogenesis associated 7, anticorps SPATA7, anticorps Spata7

Sujet: The gene which encodes the SPATA7 protein is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found.

Poids moléculaire: 68 kDa (MW of target protein)