TBC1D13 anticorps (Middle Region)

N° du produit ABIN632962

Détail du produit anti-TBC1D13 anticorps

Antigène: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D13 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D13 antibody was raised against the middle region of TBC1 13

Purification: Affinity purified

Immunogène: TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D13 Blocking Peptide, catalog no. 33R-2969, is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D13

Antigène: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Autre désignation: TBC1D13 (TBC1D13 Produits)

Synonymes: anticorps 2600014A06Rik, anticorps BC025586, anticorps TBC1 domain family member 13, anticorps TBC1 domain family, member 13, anticorps TBC1D13, anticorps Tbc1d13

Sujet: TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 44 kDa (MW of target protein)