TBC1D13 anticorps (Middle Region)

N° du produit ABIN632962

Cet anticorps Lapin Polyclonal détecte spécifiquement TBC1D13 dans WB. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour TBC1D13 anticorps (Middle Region) (ABIN632962)

Antigène: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TBC1D13 anticorps

Épitope: Middle Region

Specificité: TBC1 D13 antibody was raised against the middle region of TBC1 13

Purification: Affinity purified

Immunogène: TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D13 Blocking Peptide, (ABIN938355), is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D13

Antigène: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Autre désignation: TBC1D13

Sujet: TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 44 kDa (MW of target protein)