HYLS1 anticorps (Middle Region)

N° du produit ABIN632964

Détail du produit anti-HYLS1 anticorps

Antigène: HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HYLS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HYLS1 antibody was raised against the middle region of HYLS1

Purification: Affinity purified

Immunogène: HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HYLS1 Blocking Peptide, catalog no. 33R-10093, is also available for use as a blocking control in assays to test for specificity of this HYLS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HYLS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HYLS1

Antigène: HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))

Autre désignation: HYLS1 (HYLS1 Produits)

Synonymes: anticorps HLS, anticorps 3010015K02Rik, anticorps HYLS1, centriolar and ciliogenesis associated, anticorps HYLS1, anticorps Hyls1

Sujet: This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Poids moléculaire: 34 kDa (MW of target protein)