Cytohesin 4 anticorps (N-Term)

N° du produit ABIN632981

Détail du produit anti-Cytohesin 4 anticorps

Antigène: Cytohesin 4 (CYTH4)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytohesin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PSCD4 antibody was raised against the N terminal of PSCD4

Purification: Affinity purified

Immunogène: PSCD4 antibody was raised using the N terminal of PSCD4 corresponding to a region with amino acids NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSCD4 Blocking Peptide, catalog no. 33R-6747, is also available for use as a blocking control in assays to test for specificity of this PSCD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSCD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytohesin 4

Antigène: Cytohesin 4 (CYTH4)

Autre désignation: PSCD4 (CYTH4 Produits)

Synonymes: anticorps zgc:175224, anticorps CYT4, anticorps DJ63G5.1, anticorps PSCD4, anticorps 2510004M07Rik, anticorps 5830469K17Rik, anticorps AI467541, anticorps Pscd4, anticorps mFLJ00017, anticorps RGD1564842, anticorps cytohesin-4, anticorps cytohesin 4b, anticorps cytohesin 4, anticorps cyth4b, anticorps CYTH4, anticorps Cyth4

Sujet: PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain.

Poids moléculaire: 46 kDa (MW of target protein)