CPEB3 anticorps (Middle Region)

N° du produit ABIN632985

Détail du produit anti-CPEB3 anticorps

Antigène: CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPEB3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CPEB3 antibody was raised against the middle region of CPEB3

Purification: Affinity purified

Immunogène: CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPEB3 Blocking Peptide, catalog no. 33R-8220, is also available for use as a blocking control in assays to test for specificity of this CPEB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPEB3

Antigène: CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))

Autre désignation: CPEB3 (CPEB3 Produits)

Synonymes: anticorps si:ch211-129m12.2, anticorps 4831444O18Rik, anticorps mKIAA0940, anticorps RGD1564670, anticorps cytoplasmic polyadenylation element binding protein 3, anticorps cpeb3, anticorps CPEB3, anticorps LOAG_07772, anticorps Cpeb3

Sujet: The function of CPEB3 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 76 kDa (MW of target protein)