CPEB3 anticorps (Middle Region)
-
- Antigène Voir toutes CPEB3 Anticorps
- CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPEB3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CPEB3 antibody was raised against the middle region of CPEB3
- Purification
- Affinity purified
- Immunogène
- CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG
- Top Product
- Discover our top product CPEB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CPEB3 Blocking Peptide, catalog no. 33R-8220, is also available for use as a blocking control in assays to test for specificity of this CPEB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))
- Autre désignation
- CPEB3 (CPEB3 Produits)
- Synonymes
- anticorps si:ch211-129m12.2, anticorps 4831444O18Rik, anticorps mKIAA0940, anticorps RGD1564670, anticorps cytoplasmic polyadenylation element binding protein 3, anticorps cpeb3, anticorps CPEB3, anticorps LOAG_07772, anticorps Cpeb3
- Sujet
- The function of CPEB3 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 76 kDa (MW of target protein)
-