Ribose 5-Phosphate Isomerase A (RPIA) anticorps

N° du produit ABIN632996

Détail du produit

Antigène: Ribose 5-Phosphate Isomerase A (RPIA)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPIA Blocking Peptide, catalog no. 33R-6341, is also available for use as a blocking control in assays to test for specificity of this RPIA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPIA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Ribose 5-Phosphate Isomerase A (RPIA)

Autre désignation: RPIA (RPIA Produits)

Synonymes: anticorps MGC83218, anticorps RPI, anticorps zgc:103524, anticorps ribose 5-phosphate isomerase A L homeolog, anticorps ribose-5-phosphate isomerase, anticorps ribose 5-phosphate isomerase A, anticorps ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase), anticorps rpia.L, anticorps LOC475755, anticorps RPIA, anticorps MSP_RS04925, anticorps EAMY_RS20365, anticorps Rpia, anticorps rpia

Sujet: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Ribonucleoside Biosynthetic Process