MRPS6 anticorps (Middle Region)

N° du produit ABIN633030

Détail du produit anti-MRPS6 anticorps

Antigène: MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPS6 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPS6 antibody was raised against the middle region of MRPS6

Purification: Affinity purified

Immunogène: MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPS6 Blocking Peptide, catalog no. 33R-9511, is also available for use as a blocking control in assays to test for specificity of this MRPS6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPS6

Antigène: MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))

Autre désignation: MRPS6 (MRPS6 Produits)

Synonymes: anticorps C21orf101, anticorps MRP-S6, anticorps RPMS6, anticorps S6mt, anticorps AW046321, anticorps BcDNA:RH10862, anticorps CG15016, anticorps Dmel\\CG15016, anticorps Mrps6, anticorps zgc:153390, anticorps mitochondrial ribosomal protein S6, anticorps MRPS6, anticorps Mrps6, anticorps mRpS6, anticorps mrps6

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.

Poids moléculaire: 14 kDa (MW of target protein)