TINAG anticorps (Middle Region)

N° du produit ABIN633037

Cet anticorps Lapin Polyclonal détecte spécifiquement TINAG dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour TINAG anticorps (Middle Region) (ABIN633037)

Antigène: TINAG (Tubulointerstitial Nephritis Antigen (TINAG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TINAG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TINAG anticorps

Épitope: Middle Region

Specificité: TINAG antibody was raised against the middle region of TINAG

Purification: Affinity purified

Immunogène: TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TINAG Blocking Peptide, (ABIN5616610), is also available for use as a blocking control in assays to test for specificity of this TINAG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TINAG

Antigène: TINAG (Tubulointerstitial Nephritis Antigen (TINAG))

Autre désignation: TINAG

Sujet: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Poids moléculaire: 54 kDa (MW of target protein)