OMA1 anticorps

N° du produit ABIN633039

Détail du produit anti-OMA1 anticorps

Antigène: OMA1 (OMA1 Zinc Metallopeptidase Homolog (OMA1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OMA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: OMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OMA1 Blocking Peptide, catalog no. 33R-9932, is also available for use as a blocking control in assays to test for specificity of this OMA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OMA1

Antigène: OMA1 (OMA1 Zinc Metallopeptidase Homolog (OMA1))

Autre désignation: OMA1 (OMA1 Produits)

Synonymes: anticorps 2010001O09Rik, anticorps DAB1, anticorps MPRP-1, anticorps YKR087C, anticorps ZMPOMA1, anticorps peptidase, anticorps RGD1304821, anticorps oma1, anticorps OMA1 zinc metallopeptidase, anticorps si:ch73-215a11.1, anticorps olfactory receptor 4K2, anticorps OMA1, anticorps Oma1, anticorps si:ch73-215a11.1, anticorps LOC531304

Sujet: OMA1 is a mitochondrial protease.

Poids moléculaire: 60 kDa (MW of target protein)